PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000167314
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 257aa    MW: 29408.3 Da    PI: 9.4432
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000167314genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.3e-162468448
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     W +eEd++l+++v+ +G g+W+t+++  g++R +k+c++rw +yl
    MDP0000167314 24 WKPEEDLILKQYVETHGEGNWATVSKLSGLKRGGKSCRLRWKNYL 68
                     *****************************99************97 PP

2Myb_DNA-binding49.97.2e-1674119148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++++E +l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000167314  74 RGDMSQDEKDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 119
                      7899******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3371668IPR017930Myb domain
SuperFamilySSF466897.7E-2819115IPR009057Homeodomain-like
SMARTSM007172.6E-122070IPR001005SANT/Myb domain
CDDcd001676.18E-112468No hitNo description
PfamPF002497.2E-142468IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-202475IPR009057Homeodomain-like
PROSITE profilePS5129423.92369123IPR017930Myb domain
SMARTSM007171.8E-1573121IPR001005SANT/Myb domain
PfamPF002494.4E-1474119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2276122IPR009057Homeodomain-like
CDDcd001672.69E-1177119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MVMAKNKRSS VVKAGNARPK KNWWKPEEDL ILKQYVETHG EGNWATVSKL SGLKRGGKSC  60
RLRWKNYLRP NIKRGDMSQD EKDLIIRMHK LLGNRWSLIA GRLPGRTDNE VKNYWNTHLN  120
KNTSCCPAGG KRKGXSMTDY SNHDTNITKK KNKINTSKTS STATATADNP MIISSTVRSP  180
KDTNSDHHHQ HHEEPNDGPI FATTSTTEES CFYYDVDIES PRELHYYMPS CSSXFNPAFX  240
FDDEPFIGYM DPFLLFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-222412310108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008377302.10.0PREDICTED: transcription factor MYB82
SwissprotQ9LTF78e-67MYB82_ARATH; Transcription factor MYB82
TrEMBLW9SZ251e-76W9SZ25_9R
STRINGPOPTR_0018s12780.13e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF135452026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.14e-65myb domain protein 82